A19315
GTF2F1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A19315
- Zusätzliche Namen:
- BTF4|GTF2F1|RAP74|TF2F1|TFIIF
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 74kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- PSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
- Uniprot:
- P35269
- Synonyme:
- BTF4;general transcription factor IIF 74 kDa subunit;general transcription factor IIF subunit 1;general transcription factor IIF, polypeptide 1, 74kDa;RAP74;TF2F1;TFIIF;TFIIF-alpha;transcription initiation factor IIF subunit alpha;transcription initiation factor RAP74
- Weitere Details:
- Enables several functions, including RNA polymerase II general transcription initiation factor activity; phosphatase activator activity; and promoter-specific chromatin binding activity. Involved in several processes, including positive regulation of transcription by RNA polymerase II; response to virus; and transcription initiation from RNA polymerase II promoter. Located in cell junction and nucleoplasm. Part of transcription factor TFIID complex.
- Versandbedingungen:
- Blue Ice