GJA8 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A19312
Zusätzliche Namen:: CAE|CAE1|CTRCT1|CX50|CZP1|GJA8|MP70
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSKASSRARSDDLTV
Uniprot:: P48165
Synonyme:: CAE;CAE1;cell surface glycoprotein;connexin 50;Connexin-50;CTRCT1;CX50;CZP1;gap junction alpha 8;gap junction alpha-8 protein;gap junction membrane channel protein alpha-8;gap junction protein alpha 8 50kDa;lens fiber protein MP70;lens intrinsic membrane protein MP70;MP70
Weitere Details:: This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome.