A1930
CD151 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1930
- Zusätzliche Namen:
- CD151|EBS7|GP27|MER2|PETA-3|RAPH|SFA1|TSPAN24
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR
- Uniprot:
- P48509
- Synonyme:
- CD151 antigen;CD151 antigen (Raph blood group);GP27;hemidesmosomal tetraspanin CD151;membrane glycoprotein SFA-1;MER2;PETA-3;platelet surface glycoprotein gp27;platelet-endothelial cell tetraspan antigen 3;platelet-endothelial tetraspan antigen 3;RAPH;SFA1;tetraspanin-24;tspan-24;TSPAN24
- Weitere Details:
- The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.
- Versandbedingungen:
- Blue Ice