RCHY1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19287
Zusätzliche Namen:: ARNIP|CHIMP|PIRH2|PRO1996|RCHY1|RNF199|ZCHY|ZNF363
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ
Uniprot:: Q96PM5
Synonyme:: Androgen receptor N-terminal-interacting protein;androgen-receptor N-terminal-interacting protein;ARNIP;CH-rich interacting match with PLAG1;CH-rich-interacting match with PLAG1;CHIMP;E3 ubiquitin-protein ligase Pirh2;p53-induced protein with a RING-H2 domain;p53-induced RING-H2 protein;PIRH2;PRO1996;ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase;RING finger and CHY zinc finger domain-containing protein 1;RING finger protein 199;RING-type E3 ubiquitin transferase RCHY1;RNF199;ZCHY;zinc finger protein 363;zinc finger, CHY-type;ZNF363
Weitere Details:: The protein encoded by this gene has ubiquitin ligase activity. It mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including tumor protein 53, histone deacetylase 1, and cyclin-dependent kinase inhibitor 1B, thus regulating their levels and cell cycle progression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Versandbedingungen:: Blue Ice