A19268
Human EG-VEGF/PK1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19268
- Zusätzliche Namen:
- EGVEGF|PK1|PRK1|PROK1
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF
- Uniprot:
- P58294
- Synonyme:
- black mamba toxin-related protein;EG-VEGF;EGVEGF;endocrine-gland-derived vascular endothelial growth factor;mambakine;PK1;PRK1;prokineticin-1
- Weitere Details:
- The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and non-endothelial cell types. Its expression is restricted to the steroidogenic glands (ovary, testis, adrenal, and placenta), is induced by hypoxia, and often complementary to the expression of vascular endothelial growth factor (VEGF), suggesting that these molecules function in a coordinated manner.
- Versandbedingungen:
- Blue Ice