LHX2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19265
Zusätzliche Namen:: hLhx2|LH2|LHX2
Anwendung:: ELISA, WB
Molekulargewicht:: 44 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSI
Uniprot:: P50458
Synonyme:: hLhx2;homeobox protein LH-2;LH2;LIM homeobox protein 2;LIM HOX gene 2;LIM/homeobox protein Lhx2
Weitere Details:: This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.