PITX3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19261
Zusätzliche Namen:: ASGD1|ASMD|ASOD|CTPP4|CTRCT11|PITX3|PTX3
Anwendung:: ELISA, WB
Molekulargewicht:: 32kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEFGLLSEAEARSPALSLSDAGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTN
Uniprot:: O75364
Synonyme:: ASGD1;ASMD;ASOD;CTPP4;CTRCT11;homeobox protein PITX3;Paired-like homeodomain transcription factor 3;pituitary homeobox 3;PTX3
Weitere Details:: This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.