A19260
Dynamin 3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19260
- Zusätzliche Namen:
- Dyna III|Dynamin 3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ELLAQLYSSEDQNTLMEESAEQAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRPTLSAPLARPTSGRGPAPAIP
- Uniprot:
- Q9UQ16
- Synonyme:
- Dyna III;dynamin family member;dynamin-3;dynamin, testicular;T-dynamin
- Weitere Details:
- This gene encodes a member of a family of guanosine triphosphate (GTP)-binding proteins that associate with microtubules and are involved in vesicular transport. The encoded protein functions in the development of megakaryocytes. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice