SERPING1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19259
Zusätzliche Namen:: C1IN|C1INH|C1NH|HAE1|HAE2|SERPING1
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLKLYHAFSAMKKVETNMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV
Uniprot:: P05155
Synonyme:: C1 esterase inhibitor;C1-inhibiting factor;C1-inhibitor;C1IN;C1INH;C1NH;complement component 1 inhibitor;epididymis secretory sperm binding protein;HAE1;HAE2;plasma protease C1 inhibitor;serine/cysteine proteinase inhibitor clade G member 1;serpin G1;serpin peptidase inhibitor clade G member 1;serpin peptidase inhibitor, clade G (C1 inhibitor), member 1
Weitere Details:: This gene encodes a highly glycosylated plasma protein involved in the regulation of the complement cascade. Its encoded protein, C1 inhibitor, inhibits activated C1r and C1s of the first complement component and thus regulates complement activation. It is synthesized in the liver, and its deficiency is associated with hereditary angioneurotic oedema (HANE). Alternative splicing results in multiple transcript variants encoding the same isoform.