A19253
SMG1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19253
- Zusätzliche Namen:
- 61E3.4|ATX|LIP|SMG1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 411 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
- Uniprot:
- Q96Q15
- Synonyme:
- 61E3.4;ATX;lambda-interacting protein;lambda/iota protein kinase C-interacting protein;LIP;PI-3-kinase-related kinase SMG-1;serine/threonine-protein kinase SMG1;smg-1 homolog, phosphatidylinositol 3-kinase-related kinase;SMG1 phosphatidylinositol 3-kinase-related kinase
- Weitere Details:
- This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternatively spliced transcript variants have been described, but their full-length nature has yet to be determined.
- Versandbedingungen:
- Blue Ice