A19248
beta glucuronidase (GUSB) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19248
- Zusätzliche Namen:
- beta glucuronidase (GUSB)|BG|MPS7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEEQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVW
- Uniprot:
- P08236
- Synonyme:
- beta-D-glucuronidase;beta-G1;beta-glucuronidase;BG;MPS7
- Weitere Details:
- This gene encodes a hydrolase that degrades glycosaminoglycans, including heparan sulfate, dermatan sulfate, and chondroitin-4,6-sulfate. The enzyme forms a homotetramer that is localized to the lysosome. Mutations in this gene result in mucopolysaccharidosis type VII. Alternative splicing results in multiple transcript variants. There are many pseudogenes of this locus in the human genome.
- Versandbedingungen:
- Blue Ice