A19245
GOT2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19245
- Zusätzliche Namen:
- DEE82|GOT2|KAT4|KATIV|KYAT4|mitAAT
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIG
- Uniprot:
- P00505
- Synonyme:
- aspartate aminotransferase 2;aspartate aminotransferase, mitochondrial;aspartate transaminase 2;DEE82;FABP-1;FABPpm;fatty acid-binding protein;glutamate oxaloacetate transaminase 2;glutamic-oxaloacetic transaminase 2, mitochondrial;KAT4;KATIV;KYAT4;kynurenine aminotransferase 4;kynurenine aminotransferase IV;kynurenine--oxoglutarate transaminase 4;kynurenine--oxoglutarate transaminase IV;mAspAT;mitAAT;plasma membrane-associated fatty acid-binding protein;transaminase A
- Weitere Details:
- Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice