A19242
VEGF-D Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19242
- Zusätzliche Namen:
- FIGF|VEGF-D
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- YSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
- Uniprot:
- O43915
- Synonyme:
- c-fos induced growth factor (vascular endothelial growth factor D);c-Fos-induced growth factor;FIGF;vascular endothelial growth factor D;VEGF-D
- Weitere Details:
- The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus.
- Versandbedingungen:
- Blue Ice