A19238
RanBP9 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19238
- Zusätzliche Namen:
- BPM-L|BPM90|RanBP7|RanBP9|RANBPM
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 80kDa/91kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAA
- Uniprot:
- Q96S59
- Synonyme:
- BPM-L;BPM90;novel centrosomal protein RanBPM;Ran Binding Protein in the Microtubule organizing center;ran binding protein, centrosomal;ran-binding protein 9;ran-binding protein M;RanBP7;RANBPM
- Weitere Details:
- This gene encodes a protein that binds RAN, a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The protein encoded by this gene has also been shown to interact with several other proteins, including met proto-oncogene, homeodomain interacting protein kinase 2, androgen receptor, and cyclin-dependent kinase 11.
- Versandbedingungen:
- Blue Ice