A19236
RGAP1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19236
- Zusätzliche Namen:
- CDAN3B|CYK4|HsCYK-4|ID-GAP|MgcRacGAP|RGAP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 71 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQI
- Uniprot:
- Q9H0H5
- Synonyme:
- CYK4;HsCYK-4;ID-GAP;male germ cell RacGap;MgcRacGAP;protein CYK4 homolog;rac GTPase-activating protein 1
- Weitere Details:
- This gene encodes a GTPase-activating protein (GAP) that is a compoment of the centralspindlin complex. This protein binds activated forms of Rho GTPases and stimulates GTP hydrolysis, which results in negative regulation of Rho-mediated signals. This protein plays a regulatory role in cytokinesis, cell growth, and differentiation. Alternatively spliced transcript variants have been found for this gene. There is a pseudogene for this gene on chromosome 12.
- Versandbedingungen:
- Blue Ice