A19228
LCAT Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19228
- Zusätzliche Namen:
- LCAT|lecithin-cholesterol acyltransferase
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWI
- Uniprot:
- P04180
- Synonyme:
- 1-alkyl-2-acetylglycerophosphocholine esterase;Lecithin-cholesterol acyltransferase;PAF acetylhydrolase;phosphatidylcholine--sterol O-acyltransferase;phosphatidylcholine-sterol acyltransferase;phospholipid-cholesterol acyltransferase;platelet-activating factor acetylhydrolase;testicular secretory protein Li 24
- Weitere Details:
- This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.
- Versandbedingungen:
- Blue Ice