A19227
Alpha SNAP Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19227
- Zusätzliche Namen:
- Alpha SNAP|SNAPA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
- Uniprot:
- P54920
- Synonyme:
- alpha-SNAP;alpha-soluble NSF attachment protein;N-ethylmaleimide-sensitive factor attachment protein alpha;N-ethylmaleimide-sensitive factor attachment protein, alpha;SNAPA
- Weitere Details:
- This gene encodes a member of the soluble NSF attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. The encoded protein plays a role in the completion of membrane fusion by mediating the interaction of N-ethylmaleimide-sensitive factor (NSF) with the vesicle-associated and membrane-associated SNAP receptor (SNARE) complex, and stimulating the ATPase activity of NSF. Alternatively spliced transcript variants have been observed for this gene.
- Versandbedingungen:
- Blue Ice