A19226
LPP Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19226
- Zusätzliche Namen:
- lipoma-preferred partner|LPP
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFK
- Uniprot:
- Q93052
- Synonyme:
- LIM domain-containing preferred translocation partner in lipoma;LIM protein;lipoma preferred partner;lipoma-preferred partner
- Weitere Details:
- This gene encodes a member of a subfamily of LIM domain proteins that are characterized by an N-terminal proline-rich region and three C-terminal LIM domains. The encoded protein localizes to the cell periphery in focal adhesions and may be involved in cell-cell adhesion and cell motility. This protein also shuttles through the nucleus and may function as a transcriptional co-activator. This gene is located at the junction of certain disease-related chromosomal translocations, which result in the expression of chimeric proteins that may promote tumor growth. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice