Transferrin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19130
Zusätzliche Namen:: HEL-S-71p|PRO1557|PRO2086|TFQTL1|Transferrin
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 77kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIP
Uniprot:: P02787
Synonyme:: beta-1 metal-binding globulin;epididymis secretory sperm binding protein Li 71p;HEL-S-71p;PRO1557;PRO2086;serotransferrin;siderophilin;TFQTL1
Weitere Details:: This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.