TNFR2/TNFRSF1B Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19127
Zusätzliche Namen:: CD120b|p75|p75TNFR|TBPII|TNF-R-II|TNF-R75|TNFBR|TNFR1B|TNFR2|TNFR2/TNFRSF1B|TNFR80
Anwendung:: ELISA, WB
Molekulargewicht:: 68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
Uniprot:: P20333
Synonyme:: CD120b;p75;p75 TNF receptor;p75TNFR;p80 TNF-alpha receptor;soluble TNFR1B variant 1;TBPII;TNF-R-II;TNF-R2;TNF-R75;TNF-RII;TNFBR;TNFR1B;TNFR2;TNFR80;tumor necrosis factor beta receptor;tumor necrosis factor binding protein 2;tumor necrosis factor receptor 2;tumor necrosis factor receptor superfamily member 1B;tumor necrosis factor receptor type II
Weitere Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways.

Versandbedingungen:: Blue Ice