[KO Validated] Src Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19119
Zusätzliche Namen:: ASV|c-SRC|p60-Src|rc|SRC1|THC6
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 60 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
Uniprot:: P12931
Synonyme:: ASV;c-SRC;p60-Src;pp60c-src;proto-oncogene c-Src;proto-oncogene tyrosine-protein kinase Src;protooncogene SRC, Rous sarcoma;SRC1;THC6;tyrosine kinase pp60c-src;tyrosine-protein kinase SRC-1;v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
Weitere Details:: This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.