A19119
[KO Validated] Src Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19119
- Zusätzliche Namen:
- ASV|c-SRC|p60-Src|rc|SRC1|THC6
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 60 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
- Uniprot:
- P12931
- Synonyme:
- ASV;c-SRC;p60-Src;pp60c-src;proto-oncogene c-Src;proto-oncogene tyrosine-protein kinase Src;protooncogene SRC, Rous sarcoma;SRC1;THC6;tyrosine kinase pp60c-src;tyrosine-protein kinase SRC-1;v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog
- Weitere Details:
- This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_1.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_2.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_3.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_4.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_5.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_ARC0378_KO-WB_01.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_ARC0378-02_WB_01.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_ARC0378-02_WB_02.jpg)
![[KO Validated] Src Rabbit monoclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A19119/A19119_ARC0378_IHC_01.jpg)