A19111
SHP1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19111
- Zusätzliche Namen:
- HCP|HCPH|HPTP1C|PTP-1C|SH-PTP1|SHP-1|SHP-1L|SHP1
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 68kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
- Uniprot:
- P29350
- Synonyme:
- HCP;HCPH;hematopoietic cell phosphatase;hematopoietic cell protein-tyrosine phosphatase;HPTP1C;protein-tyrosine phosphatase 1C;protein-tyrosine phosphatase SHP-1;PTP-1C;SH-PTP1;SHP-1;SHP-1L;SHP1;tyrosine-protein phosphatase non-receptor type 6
- Weitere Details:
- The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. N-terminal part of this PTP contains two tandem Src homolog (SH2) domains, which act as protein phospho-tyrosine binding domains, and mediate the interaction of this PTP with its substrates. This PTP is expressed primarily in hematopoietic cells, and functions as an important regulator of multiple signaling pathways in hematopoietic cells. This PTP has been shown to interact with, and dephosphorylate a wide spectrum of phospho-proteins involved in hematopoietic cell signaling. Multiple alternatively spliced variants of this gene, which encode distinct isoforms, have been reported.
- Versandbedingungen:
- Blue Ice