DJ-1/PARK7 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19097
Zusätzliche Namen:: DJ-1|DJ-1/PARK7|DJ1|GATD2|HEL-S-67p
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 23 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG
Uniprot:: Q99497
Synonyme:: DJ-1;DJ1;epididymis secretory sperm binding protein Li 67p;GATD2;HEL-S-67p;maillard deglycase;oncogene DJ1;Parkinson disease (autosomal recessive, early onset) 7;Parkinson disease protein 7;parkinson protein 7;Parkinsonism-associated deglycase;protein deglycase DJ-1;protein DJ-1;protein/nucleic acid deglycase DJ-1
Weitere Details:: The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene.