Osteopontin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19092
Zusätzliche Namen:: BNSP|BSPI|ETA-1|OPN|Osteopontin
Anwendung:: ELISA, WB
Molekulargewicht:: 35kDa/65kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF
Uniprot:: P10451
Synonyme:: BNSP;Bone sialoprotein 1;BSPI;early T-lymphocyte activation 1;ETA-1;nephropontin;OPN;osteopontin;osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein;Secreted phosphoprotein 1;secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1);secreted phosphoprotein 1 variant 6;SPP1/CALPHA1 fusion;urinary stone protein;uropontin
Weitere Details:: The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.