A19086
NeuN Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19086
- Zusätzliche Namen:
- FOX-3|FOX3|HRNBP3|NEUN
- Anwendung:
- ELISA, IHC, WB, IHC-P, IF
- Molekulargewicht:
- 46-55 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
- Uniprot:
- A6NFN3
- Synonyme:
- fox-1 homolog C;FOX-3;FOX3;hexaribonucleotide binding protein 3;HRNBP3;NEUN;neuN antigen;neuronal nuclei antigen;RNA binding protein fox-1 homolog 3;RNA binding protein, fox-1 homolog 3
- Weitere Details:
- This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice








