[KO Validated] TAK1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19077
Zusätzliche Namen:: CSCF|FMD2|MEKK7|TAK1|TGF1a
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 75 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
Uniprot:: O43318
Synonyme:: CSCF;FMD2;MEKK7;mitogen-activated protein kinase kinase kinase 7;TAK1;TGF-beta activated kinase 1;TGF1a;transforming growth factor-beta-activated kinase 1
Weitere Details:: The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase mediates the signaling transduction induced by TGF beta and morphogenetic protein (BMP), and controls a variety of cell functions including transcription regulation and apoptosis. In response to IL-1, this protein forms a kinase complex including TRAF6, MAP3K7P1/TAB1 and MAP3K7P2/TAB2; this complex is required for the activation of nuclear factor kappa B. This kinase can also activate MAPK8/JNK, MAP2K4/MKK4, and thus plays a role in the cell response to environmental stresses. Four alternatively spliced transcript variants encoding distinct isoforms have been reported.