A19071
Integrin alpha V (ITGAV/CD51) Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19071
- Zusätzliche Namen:
- CD51|Integrin alpha V (ITGAV/CD51)|MSK8|VNRA|VTNR
- Anwendung:
- ELISA, Flow Cytometry, WB, IHC-P
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
- Uniprot:
- P06756
- Synonyme:
- antigen identified by monoclonal antibody L230;CD51;integrin alpha-V;integrin alphaVbeta3;integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51);MSK8;Vitronectin receptor;vitronectin receptor subunit alpha;VNRA;VTNR
- Weitere Details:
- The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes.
- Versandbedingungen:
- Blue Ice