GST3/GSTP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19061
Zusätzliche Namen:: DFN7|FAEES3|GST3|GST3/GSTP1|GSTP|HEL-S-22|PI
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN
Uniprot:: P09211
Synonyme:: deafness, X-linked 7;DFN7;epididymis secretory protein Li 22;FAEES3;fatty acid ethyl ester synthase III;glutathione S-transferase P;GST class-pi;GST3;GSTP;GSTP1-1;HEL-S-22;PI
Weitere Details:: Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.