[KO Validated] GSK3A Alpha Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19060
Zusätzliche Namen:: 3A Alpha|GSK3 alpha|GSK3A
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 51kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKV
Uniprot:: P49840
Synonyme:: glycogen synthase kinase-3 alpha;GSK-3 alpha;serine/threonine-protein kinase GSK3A
Weitere Details:: This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.