HNF3B Beta/FOXA2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19053
Zusätzliche Namen:: HNF-3-beta|HNF3B|HNF3B Beta/FOXA2|TCF3B
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVA
Uniprot:: Q9Y261
Synonyme:: forkhead box protein A2;hepatic nuclear factor-3-beta;hepatocyte nuclear factor 3-beta;HNF-3-beta;HNF3B;TCF3B;transcription factor 3B
Weitere Details:: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene.