CNPase Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19033
Zusätzliche Namen:: CNP1|CNPase|HLD20
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 48kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTII
Uniprot:: P09543
Synonyme:: 2', 3' cyclic nucleotide 3' phosphohydrolase;2',3'-cyclic-nucleotide 3'-phosphodiesterase;CNP1;CNPase;HLD20
Weitere Details:: Predicted to enable 2',3'-cyclic-nucleotide 3'-phosphodiesterase activity. Involved in substantia nigra development. Located in several cellular components, including extracellular space; microtubule; and plasma membrane. Implicated in hypomyelinating leukodystrophy 20; multiple sclerosis; and schizophrenia. Biomarker of alcoholic liver cirrhosis; multiple sclerosis; and restless legs syndrome.