A19028
CDC42 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19028
- Zusätzliche Namen:
- CDC42|CDC42Hs|G25K|TKS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 21kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
- Uniprot:
- P60953
- Synonyme:
- CDC42Hs;cell division control protein 42 homolog;dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD));dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD));G25K;G25K GTP-binding protein;growth-regulating protein;GTP binding protein, 25kDa;small GTP binding protein CDC42;TKS
- Weitere Details:
- The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20.
- Versandbedingungen:
- Blue Ice

