A19024
CD79a Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A19024
- Zusätzliche Namen:
- CD79a|IGA|IGAlpha|MB-1|MB1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 40-55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSH
- Uniprot:
- P11912
- Synonyme:
- B-cell antigen receptor complex-associated protein alpha chain;CD79a antigen (immunoglobulin-associated alpha);CD79a molecule, immunoglobulin-associated alpha;ig-alpha;IGA;MB-1;MB-1 membrane glycoprotein;membrane-bound immunoglobulin-associated protein;surface IgM-associated protein
- Weitere Details:
- The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.
- Versandbedingungen:
- Blue Ice