A19017
CD3E Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A19017
- Zusätzliche Namen:
- CD3E|CD3epsilon|IMD18|T3E|TCRE
- Anwendung:
- ELISA, IHC, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 23 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYY
- Uniprot:
- P07766
- Synonyme:
- CD3-epsilon;CD3e antigen, epsilon polypeptide (TiT3 complex);CD3e molecule, epsilon (CD3-TCR complex);IMD18;T-cell antigen receptor complex, epsilon subunit of T3;T-cell surface antigen T3/Leu-4 epsilon chain;T-cell surface glycoprotein CD3 epsilon chain;T3E;TCRE
- Weitere Details:
- The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.
- Versandbedingungen:
- Blue Ice








