[KO Validated] A Alpha-Catenin Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A19004
Zusätzliche Namen:: CAP102|in|MDBS2|MDPT2
Anwendung:: ELISA, WB
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHVLAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQ
Uniprot:: P35221
Synonyme:: Alpha E-catenin;alpha-E-catenin;Cadherin-associated protein;CAP102;catenin (cadherin-associated protein), alpha 1, 102kDa;catenin alpha-1;epididymis secretory sperm binding protein;MDPT2;renal carcinoma antigen NY-REN-13
Weitere Details:: This gene encodes a member of the catenin family of proteins that play an important role in cell adhesion process by connecting cadherins located on the plasma membrane to the actin filaments inside the cell. The encoded mechanosensing protein contains three vinculin homology domains and undergoes conformational changes in response to cytoskeletal tension, resulting in the reconfiguration of cadherin-actin filament connections. Certain mutations in this gene cause butterfly-shaped pigment dystrophy.