SLPI Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1897
Zusätzliche Namen:: ALK1|ALP|BLPI|HUSI|HUSI-I|MPI|SLPI|WAP4|WFDC4
Anwendung:: ELISA, WB
Molekulargewicht:: 12kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Uniprot:: P03973
Synonyme:: ALK1;ALP;antileukoproteinase;BLPI;HUSI;HUSI-1;HUSI-I;MPI;mucus proteinase inhibitor;protease inhibitor WAP4;Secretory leukocyte protease inhibitor;secretory leukocyte protease inhibitor (antileukoproteinase);seminal proteinase inhibitor;WAP four-disulfide core domain protein 4;WAP4;WFDC4
Weitere Details:: This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity.