A1892
CADM1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1892
- Zusätzliche Namen:
- BL2|CADM1|IGSF4|IGSF4A|Necl-2|NECL2|RA175|sgIGSF|ST17|sTSLC-1|SYNCAM|synCAM1|TSLC1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTT
- Uniprot:
- Q9BY67
- Synonyme:
- BL2;cell adhesion molecule 1;IGSF4;IGSF4A;immunoglobulin superfamily member 4;immunoglobulin superfamily, member 4D variant 1;immunoglobulin superfamily, member 4D variant 2;Necl-2;NECL2;nectin-like 2;nectin-like protein 2;RA175;sgIGSF;spermatogenic immunoglobulin superfamily;ST17;sTSLC-1;synaptic cell adhesion molecule;SYNCAM;synCAM1;truncated CADM1 protein;TSLC-1;TSLC1;TSLC1/Nectin-like 2/IGSF4;tumor suppressor in lung cancer 1
- Weitere Details:
- Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ.
- Versandbedingungen:
- Blue Ice



