A18858
SOX17 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A18858
- Zusätzliche Namen:
- SOX17|VUR3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- RDGTDPSQPAELLGEVDRTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVVSDASSAVYYCNYPDV
- Uniprot:
- Q9H6I2
- Synonyme:
- SRY (sex determining region Y)-box 17;SRY-box 17;SRY-related HMG-box transcription factor SOX17;transcription factor SOX-17;VUR3
- Weitere Details:
- This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
- Versandbedingungen:
- Blue Ice