Rad21 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18850
Zusätzliche Namen:: CDLS4|hHR21|HR21|HRAD21|MCD1|MGS|NXP1|Rad21|SCC1
Anwendung:: ChIP, ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 130kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
Uniprot:: O60216
Synonyme:: CDLS4;double-strand-break repair protein rad21 homolog;hHR21;HR21;HRAD21;kleisin;MCD1;MGS;nuclear matrix protein 1;NXP-1;NXP1;protein involved in DNA double-strand break repair;RAD21 homolog;SCC1;SCC1 homolog;sister chromatid cohesion 1
Weitere Details:: The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells.