A18837
COL16A1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18837
- Zusätzliche Namen:
- 447AA|COL16A1|FP1572
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 145kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- PRAEEARGDNSEGDPGCVGSPGLPGPPGLPGQRGEEGPPGMRGSPGPPGPIGPPGFPGAVGSPGLPGLQGERGLTGLTGDKGEPGPPGQPGYPGATGPPGL
- Uniprot:
- Q07092
- Synonyme:
- 447AA;alpha 1 type XVI collagen;collagen alpha-1(XVI) chain;collagen XVI, alpha-1 polypeptide;collagen, type XVI, alpha 1;FP1572
- Weitere Details:
- This gene encodes the alpha chain of type XVI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. High levels of type XVI collagen have been found in fibroblasts and keratinocytes, and in smooth muscle and amnion.
- Versandbedingungen:
- Blue Ice



