ATG16L1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1871
Zusätzliche Namen:: APG16L|ATG16A|ATG16L|ATG16L1|IBD10|WDR30
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 66kDa/68kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
Uniprot:: Q676U5
Synonyme:: APG16-like 1;APG16L;APG16L beta;ATG16 autophagy related 16-like 1;ATG16A;ATG16L;autophagy-related protein 16-1;IBD10;WD repeat domain 30;WDR30
Weitere Details:: The protein encoded by this gene is part of a large protein complex that is necessary for autophagy, the major process by which intracellular components are targeted to lysosomes for degradation. Defects in this gene are a cause of susceptibility to inflammatory bowel disease type 10 (IBD10). Several transcript variants encoding different isoforms have been found for this gene.