VAMP7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18698
Zusätzliche Namen:: SYBL1|TI-VAMP|TIVAMP|VAMP-7|VAMP7
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: GTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLN
Uniprot:: P51809
Synonyme:: SYBL1;synaptobrevin-like 1;synaptobrevin-like protein 1;tetanus neurotoxin-insensitive VAMP;tetanus-insensitive VAMP;TI-VAMP;TIVAMP;VAMP-7;vesicle-associated membrane protein 7
Weitere Details:: This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transport vesicles to their target membranes. Alternate splicing results in multiple transcript variants.