A18696
SUPT16H (SPT16) Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18696
- Zusätzliche Namen:
- CDC68|FACTP140|NEDDFAC|SPT16|SPT16/CDC68|SUPT16H (SPT16)
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 140kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- KEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGD
- Uniprot:
- Q9Y5B9
- Synonyme:
- CDC68;chromatin-specific transcription elongation factor 140 kDa subunit;facilitates chromatin remodeling 140 kDa subunit;facilitates chromatin transcription complex subunit SPT16;FACT 140 kDa subunit;FACT complex subunit SPT16;FACTP140;hSPT16;NEDDFAC;SPT16;SPT16/CDC68;suppressor of Ty 16 homolog
- Weitere Details:
- Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit; this gene encodes the 140 kDa subunit.
- Versandbedingungen:
- Blue Ice





