A18689
FFAR4 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18689
- Zusätzliche Namen:
- BMIQ10|FFAR4|GPR120|GPR129|GT01|O3FAR1|OB10Q|PGR4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- NPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
- Uniprot:
- Q5NUL3
- Synonyme:
- BMIQ10;free fatty acid receptor 4;G-protein coupled receptor 120;G-protein coupled receptor 129;G-protein coupled receptor GT01;G-protein coupled receptor PGR4;GPR120;GPR129;GT01;O3FAR1;omega-3 fatty acid receptor 1;PGR4
- Weitere Details:
- This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

