FFAR4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18689
Zusätzliche Namen:: BMIQ10|FFAR4|GPR120|GPR129|GT01|O3FAR1|OB10Q|PGR4
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: NPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
Uniprot:: Q5NUL3
Synonyme:: BMIQ10;free fatty acid receptor 4;G-protein coupled receptor 120;G-protein coupled receptor 129;G-protein coupled receptor GT01;G-protein coupled receptor PGR4;GPR120;GPR129;GT01;O3FAR1;omega-3 fatty acid receptor 1;PGR4
Weitere Details:: This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene.