A18659
KLF11 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18659
- Zusätzliche Namen:
- FKLF|FKLF1|KLF11|MODY7|TIEG2|Tieg3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT
- Uniprot:
- O14901
- Synonyme:
- FKLF;FKLF1;Krueppel-like factor 11;MODY7;TGFB-inducible early growth response protein 2;TIEG-2;TIEG2;Tieg3;transforming growth factor-beta-inducible early growth response protein 2
- Weitere Details:
- The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

