KLF11 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18659
Zusätzliche Namen:: FKLF|FKLF1|KLF11|MODY7|TIEG2|Tieg3
Anwendung:: ELISA, WB
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT
Uniprot:: O14901
Synonyme:: FKLF;FKLF1;Krueppel-like factor 11;MODY7;TGFB-inducible early growth response protein 2;TIEG-2;TIEG2;Tieg3;transforming growth factor-beta-inducible early growth response protein 2
Weitere Details:: The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene.