H2-Ab1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18658
Zusätzliche Namen:: Abeta|H-2Ab|H2-Ab|H2-Ab1|I-Abeta|Ia-2|Ia2|IAb|Rmcs1
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: SERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQ
Uniprot:: P06345
Synonyme:: Abe;Abeta;AI845868;H-2 class II histocompatibility antigen, A beta chain;H-2A;H-2Ab;H2-A;H2-Ab;H2-Ab_;histocompatibility 2, class II antigen A, beta 1;histocompatibility 2, class II antigen A, beta, promoter 1;I;I-A<;I-Ab;I-Abeta;Ia;Ia-2;Ia2;IAb;major histocompatibility complex class II beta chain;MHC class II H2-IA-beta-psi;response to metastatic cancers 1;Rmc;Rmcs1
Weitere Details:: Enables several functions, including peptide antigen binding activity; protein antigen binding activity; and toxic substance binding activity. Involved in several processes, including B cell affinity maturation; cellular response to interferon-gamma; and positive regulation of T-helper 1 type immune response. Acts upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II and immune response. Located in Golgi apparatus; endosome; and external side of plasma membrane. Is integral component of membrane. Part of MHC class II protein complex. Is expressed in lung; metanephros; and thymus primordium. Orthologous to human HLA-DQB2 (major histocompatibility complex, class II, DQ beta 2).

Versandbedingungen:: Blue Ice