A18650
ARID1A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A18650
- Zusätzliche Namen:
- ARID1A|B120|BAF250|BAF250a|BM029|C1orf4|CSS2|ELD|hELD|hOSA1|MRD14|OSA1|P270|SMARCF1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 242kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- LLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS
- Uniprot:
- O14497
- Synonyme:
- ARID domain-containing protein 1A;AT rich interactive domain 1A (SWI-like);AT-rich interactive domain-containing protein 1A;B120;BAF250;BAF250a;BM029;brain protein 120;BRG1-associated factor 250;BRG1-associated factor 250a;C1orf4;chromatin remodeling factor p250;CSS2;ELD;hELD;hOSA1;MRD14;osa homolog 1;OSA1;OSA1 nuclear protein;P270;SMARCF1;SWI-like protein;SWI/SNF complex protein p270;SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1
- Weitere Details:
- This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

