CXCL9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1864
Zusätzliche Namen:: CMK|crg-10|CXCL9|Humig|MIG|SCYB9
Anwendung:: ELISA, WB
Molekulargewicht:: 14 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Uniprot:: Q07325
Synonyme:: C-X-C motif chemokine 9;chemokine (C-X-C motif) ligand 9;CMK;crg-10;gamma-interferon-induced monokine;Humig;MIG;monokine induced by gamma interferon;monokine induced by interferon-gamma;SCYB9;small-inducible cytokine B9
Weitere Details:: This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded is thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils.