IFNAR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A18594
Zusätzliche Namen:: AVP|IFN-alpha-REC|IFNAR|IFNAR1|IFNBR|IFRC|IMD106
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 64kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: PSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV
Uniprot:: P17181
Synonyme:: alpha-type antiviral protein;AVP;beta-type antiviral protein;CRF2-1;cytokine receptor class-II member 1;cytokine receptor family 2 member 1;IFN-alpha-REC;IFN-alpha/beta receptor 1;IFN-R-1;IFNalpha/beta receptor 1;IFNAR;IFNBR;IFRC;interferon (alpha, beta and omega) receptor 1;interferon alpha/beta receptor 1;interferon receptor 1;interferon-alpha/beta receptor alpha chain;interferon-beta receptor 1;type I interferon receptor 1
Weitere Details:: The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The protein belongs to the type II cytokine receptor family and functions as an antiviral factor.