A18576
POU3F2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A18576
- Zusätzliche Namen:
- brn-2|BRN2|N-Oct3|oct-7|OCT7|OTF-7|OTF7|POU3F2|POUF3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHG
- Uniprot:
- P20265
- Synonyme:
- brain-2;brain-specific homeobox/POU domain protein 2;brn-2;BRN2;N-Oct3;nervous system-specific octamer-binding transcription factor N-Oct-3;oct-7;OCT7;octamer-binding protein 7;octamer-binding transcription factor 7;OTF-7;OTF7;POU domain, class 3, transcription factor 2;POUF3
- Weitere Details:
- This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.
- Versandbedingungen:
- Blue Ice